![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
![]() | Protein Malate dehydrogenase [51849] (13 species) |
![]() | Species Thermus thermophilus [TaxId:274] [82300] (7 PDB entries) identical sequence to that from the Thermus flavus enzyme |
![]() | Domain d2cvqb1: 2cvq B:0-153 [130887] Other proteins in same PDB: d2cvqa2, d2cvqb2 automated match to d1iz9a1 complexed with ndp, trs |
PDB Entry: 2cvq (more details), 2.08 Å
SCOPe Domain Sequences for d2cvqb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cvqb1 c.2.1.5 (B:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} mkapvrvavtgaagqigysllfriaagemlgkdqpvilqlleipqamkalegvvmeledc afpllagleatddpkvafkdadyallvgaaprkagmerrdllqvngkifteqgralaeva kkdvkvlvvgnpantnaliayknapglnprnfta
Timeline for d2cvqb1: