SCOPe 2.05: Domain d2cvoc2: 2cvo C:219-383

Lineage for d2cvoc2 (2cvo C:219-383)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.1: GAPDH-like [55348] (6 proteins)
   has many additional secondary structures

6. Protein Putative semialdehyde dehydrogenase [143540] (1 species)

7. Species Rice (Oryza sativa) [TaxId:4530] [143541] (1 PDB entry)
   Uniprot Q6AV34 219-383

8. Domain d2cvoc2: 2cvo C:219-383 [130882]
   Other proteins in same PDB: d2cvoa1, d2cvob1, d2cvoc1, d2cvod1
   automated match to d2cvoa2

Details for d2cvoc2

PDB Entry: 2cvo, 2.2 Å

PDB Description: Crystal structure of putative N-acetyl-gamma-glutamyl-phosphate reductase (AK071544) from rice (Oryza sativa)

PDB Compounds: (C:) putative Semialdehyde dehydrogenase

SCOPe Domain Sequences for d2cvoc2:

Sequence; same for both SEQRES and ATOM records:

>d2cvoc2 d.81.1.1 (C:219-383) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]}
cyptsiqlplvplikaklikvsniiidaksgvsgagrgakeanlyteiaegihaygikgh
rhvpeieqglseaaeskvtisftpnlicmkrgmqstmfvemapgvtandlyqhlkstyeg
eefvkllngssvphtrhvvgsnycfmnvfedripgraiiisvidn

Timeline for d2cvoc2:

• d2cvoc2 first appeared in SCOP 1.73
  
• d2cvoc2 appears in SCOPe 2.04
  
• d2cvoc2 appears in SCOPe 2.06
  
• d2cvoc2 appears in the current release, SCOPe 2.08