Lineage for d2cvob2 (2cvo B:219-383)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1915719Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 1915720Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 1915721Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 1916073Protein Putative semialdehyde dehydrogenase [143540] (1 species)
  7. 1916074Species Rice (Oryza sativa) [TaxId:4530] [143541] (1 PDB entry)
    Uniprot Q6AV34 219-383
  8. 1916076Domain d2cvob2: 2cvo B:219-383 [130880]
    Other proteins in same PDB: d2cvoa1, d2cvob1, d2cvoc1, d2cvod1
    automated match to d2cvoa2

Details for d2cvob2

PDB Entry: 2cvo (more details), 2.2 Å

PDB Description: Crystal structure of putative N-acetyl-gamma-glutamyl-phosphate reductase (AK071544) from rice (Oryza sativa)
PDB Compounds: (B:) putative Semialdehyde dehydrogenase

SCOPe Domain Sequences for d2cvob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cvob2 d.81.1.1 (B:219-383) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]}
cyptsiqlplvplikaklikvsniiidaksgvsgagrgakeanlyteiaegihaygikgh
rhvpeieqglseaaeskvtisftpnlicmkrgmqstmfvemapgvtandlyqhlkstyeg
eefvkllngssvphtrhvvgsnycfmnvfedripgraiiisvidn

SCOPe Domain Coordinates for d2cvob2:

Click to download the PDB-style file with coordinates for d2cvob2.
(The format of our PDB-style files is described here.)

Timeline for d2cvob2: