Lineage for d2cvob1 (2cvo B:68-218,B:384-415)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1828622Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 1829194Protein Putative semialdehyde dehydrogenase [141919] (1 species)
  7. 1829195Species Rice (Oryza sativa) [TaxId:4530] [141920] (1 PDB entry)
    Uniprot Q6AV34 68-218,384-415
  8. 1829197Domain d2cvob1: 2cvo B:68-218,B:384-415 [130879]
    Other proteins in same PDB: d2cvoa2, d2cvob2, d2cvoc2, d2cvod2
    automated match to d2cvoa1

Details for d2cvob1

PDB Entry: 2cvo (more details), 2.2 Å

PDB Description: Crystal structure of putative N-acetyl-gamma-glutamyl-phosphate reductase (AK071544) from rice (Oryza sativa)
PDB Compounds: (B:) putative Semialdehyde dehydrogenase

SCOPe Domain Sequences for d2cvob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cvob1 c.2.1.3 (B:68-218,B:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]}
ksgeevriavlgasgytgaeivrllanhpqfrikvmtadrkageqfgsvfphlitqdlpn
lvavkdadfsnvdavfcclphgttqeiikglpqelkivdlsadfrlrdineyaewyghsh
rapelqqeavygltevlrneirnarlvanpgXlvkgasgqavqnlnlmmglpentglqyq
plfp

SCOPe Domain Coordinates for d2cvob1:

Click to download the PDB-style file with coordinates for d2cvob1.
(The format of our PDB-style files is described here.)

Timeline for d2cvob1: