Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
Protein Putative semialdehyde dehydrogenase [141919] (1 species) |
Species Rice (Oryza sativa) [TaxId:4530] [141920] (1 PDB entry) Uniprot Q6AV34 68-218,384-415 |
Domain d2cvob1: 2cvo B:68-218,B:384-415 [130879] Other proteins in same PDB: d2cvoa2, d2cvob2, d2cvoc2, d2cvod2 automated match to d2cvoa1 |
PDB Entry: 2cvo (more details), 2.2 Å
SCOPe Domain Sequences for d2cvob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cvob1 c.2.1.3 (B:68-218,B:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} ksgeevriavlgasgytgaeivrllanhpqfrikvmtadrkageqfgsvfphlitqdlpn lvavkdadfsnvdavfcclphgttqeiikglpqelkivdlsadfrlrdineyaewyghsh rapelqqeavygltevlrneirnarlvanpgXlvkgasgqavqnlnlmmglpentglqyq plfp
Timeline for d2cvob1: