SCOPe 2.08: Domain d2cvea1: 2cve A:2-124

Lineage for d2cvea1 (2cve A:2-124)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.11: YigZ N-terminal domain-like [102772] (2 proteins)
   modification of the common fold; contains extra alpha-beta unit after strand 2, the extra strand is inserted between strands 3 and 4
   automatically mapped to Pfam PF01205

6. Protein Hypothetical protein TTHA1053, N-terminal domain [142928] (1 species)

7. Species Thermus thermophilus [TaxId:274] [142929] (1 PDB entry)
   Uniprot Q5SJF5 2-124

8. Domain d2cvea1: 2cve A:2-124 [130869]
   Other proteins in same PDB: d2cvea2
   complexed with tla

Details for d2cvea1

PDB Entry: 2cve, 1.6 Å

PDB Description: Crystal structure of a conserved hypothetical protein TT1547 from thermus thermophilus HB8

PDB Compounds: (A:) hypothetical protein TTHA1053

SCOPe Domain Sequences for d2cvea1:

Sequence; same for both SEQRES and ATOM records:

>d2cvea1 d.14.1.11 (A:2-124) Hypothetical protein TTHA1053, N-terminal domain {Thermus thermophilus [TaxId: 274]}
sltladkvvyeeeiqksrfiakaapvaseeealaflaenrepeathnghaykigllyrfs
ddgepsgtagrpilhaieaqgldrvavlvvryfggvklgagglvrayggvaaealrrapk
vpl

Timeline for d2cvea1:

• d2cvea1 first appeared in SCOP 1.73
  
• d2cvea1 appears in SCOPe 2.07