![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
![]() | Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) ![]() |
![]() | Family d.14.1.11: YigZ N-terminal domain-like [102772] (2 proteins) modification of the common fold; contains extra alpha-beta unit after strand 2, the extra strand is inserted between strands 3 and 4 automatically mapped to Pfam PF01205 |
![]() | Protein Hypothetical protein TTHA1053, N-terminal domain [142928] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [142929] (1 PDB entry) Uniprot Q5SJF5 2-124 |
![]() | Domain d2cvea1: 2cve A:2-124 [130869] Other proteins in same PDB: d2cvea2 complexed with tla |
PDB Entry: 2cve (more details), 1.6 Å
SCOPe Domain Sequences for d2cvea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cvea1 d.14.1.11 (A:2-124) Hypothetical protein TTHA1053, N-terminal domain {Thermus thermophilus [TaxId: 274]} sltladkvvyeeeiqksrfiakaapvaseeealaflaenrepeathnghaykigllyrfs ddgepsgtagrpilhaieaqgldrvavlvvryfggvklgagglvrayggvaaealrrapk vpl
Timeline for d2cvea1: