Lineage for d2cvca1 (2cvc A:40-544)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 649671Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 649672Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 649673Family a.138.1.1: Cytochrome c3-like [48696] (4 proteins)
  6. 649674Protein 16-heme cytochrome c HmcA [81940] (1 species)
    tandem repeat of four cytochrome c3-like domains
  7. 649675Species Desulfovibrio vulgaris [TaxId:881] [81941] (3 PDB entries)
  8. 649676Domain d2cvca1: 2cvc A:40-544 [130860]
    automatically matched to d1h29c_
    complexed with hem

Details for d2cvca1

PDB Entry: 2cvc (more details), 2 Å

PDB Description: Crystal structure of High-Molecular Weight Cytochrome c from Desulfovibrio vulgaris (Hildenborough)
PDB Compounds: (A:) High-molecular-weight cytochrome c precursor

SCOP Domain Sequences for d2cvca1:

Sequence, based on SEQRES records: (download)

>d2cvca1 a.138.1.1 (A:40-544) 16-heme cytochrome c HmcA {Desulfovibrio vulgaris [TaxId: 881]}
ekradlieigamerfgkldlpkvafrhdqhttavtgmgkdcaachkskdgkmslkfmrld
dnsaaelkeiyhancigchtdlakagkktgpqdgecrschnpkpsaasswkeigfdkslh
yrhvaskaikpvgdpqkncgachhvydeaskklvwgknkedscrachgekpvdkrpaldt
aahtacischmdvaktkaetgpvncagchapeaqakfkvvrevprldrgqpdaalilpvp
gkdapremkgtmkpvafdhkaheakandcrtchhvridtctachtvngtadskfvqleka
mhqpdsmrscvgchntrvqqptcagchgfikptksdaqcgvchvaapgfdakqveagall
nlkaeqrsqvaasmlsarpqpkgtfdlndipekvvigsiakeyqpsefphrkivktliag
igedklaatfhiekgtlcqgchhnspasltppkcaschgkpfdadrgdrpglkaayhqqc
mgchdrmkiekpantacvdchkera

Sequence, based on observed residues (ATOM records): (download)

>d2cvca1 a.138.1.1 (A:40-544) 16-heme cytochrome c HmcA {Desulfovibrio vulgaris [TaxId: 881]}
ekradlieigamerfgkldlpkvafrhdqhttavtgmgkdcaachkskdgkmslkfmrld
dnsaaelkeiyhancigchtdlakagkktgpqdgecrschnpkpsaasswkeigfdkslh
yrhvaskaikpvgdpqkncgachhvydeaskklvwgknkedscrachgekpvdkrpaldt
aahtacischmdvaktkaetgpvncagchapeaqakfkvvrevprldrgqpdaalilpvp
gkdapremkgtmkpvafdhkaheakandcrtchhvridtctachtvngtadskfvqleka
mhqpdsmrscvgchntrvqqptcagchgfikptksdaqcgvchvaapgfdakqveagall
nlkaeqrsqvaasmlsarpqpkgtfdlndipekvvigsiakeyqpsefphrkivktliag
igedklaatfhiekgtlcqgchhnspasltppkcaschgkpdrpglkaayhqqcmgchdr
mkiekpantacvdchkera

SCOP Domain Coordinates for d2cvca1:

Click to download the PDB-style file with coordinates for d2cvca1.
(The format of our PDB-style files is described here.)

Timeline for d2cvca1: