Lineage for d2cvba1 (2cvb A:2-188)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2132842Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2133092Protein Probable thiol-disulfide isomerase/thioredoxin TTHA0593 [142389] (1 species)
  7. 2133093Species Thermus thermophilus [TaxId:274] [142390] (2 PDB entries)
    Uniprot Q5SKQ0 2-188
  8. 2133094Domain d2cvba1: 2cvb A:2-188 [130859]

Details for d2cvba1

PDB Entry: 2cvb (more details), 1.8 Å

PDB Description: Crystal structure of a thioredoxin-like protein from Thermus thermophilus HB8
PDB Compounds: (A:) probable thiol-disulfide isomerase/thioredoxin

SCOPe Domain Sequences for d2cvba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cvba1 c.47.1.10 (A:2-188) Probable thiol-disulfide isomerase/thioredoxin TTHA0593 {Thermus thermophilus [TaxId: 274]}
lqypelplesplidaelpdprggryrlsqfhepllavvfmcnhcpyvkgsigelvalaer
yrgkvafvginandyekypedapekmaafaeehgiffpylldetqevakayralrtpevf
lfderrllryhgrvndnpkdpskvqshdleaaieallrgeepplkeapaigctikwrpgn
epevrig

SCOPe Domain Coordinates for d2cvba1:

Click to download the PDB-style file with coordinates for d2cvba1.
(The format of our PDB-style files is described here.)

Timeline for d2cvba1: