![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
![]() | Protein Probable thiol-disulfide isomerase/thioredoxin TTHA0593 [142389] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [142390] (2 PDB entries) Uniprot Q5SKQ0 2-188 |
![]() | Domain d2cvba1: 2cvb A:2-188 [130859] |
PDB Entry: 2cvb (more details), 1.8 Å
SCOPe Domain Sequences for d2cvba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cvba1 c.47.1.10 (A:2-188) Probable thiol-disulfide isomerase/thioredoxin TTHA0593 {Thermus thermophilus [TaxId: 274]} lqypelplesplidaelpdprggryrlsqfhepllavvfmcnhcpyvkgsigelvalaer yrgkvafvginandyekypedapekmaafaeehgiffpylldetqevakayralrtpevf lfderrllryhgrvndnpkdpskvqshdleaaieallrgeepplkeapaigctikwrpgn epevrig
Timeline for d2cvba1: