SCOP 1.75: Domain d2cv9d1: 2cv9 D:1-252

Lineage for d2cv9d1 (2cv9 D:1-252)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (12 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.10: TTHA0625-like [143938] (1 protein)
   part of Pfam PF00149

6. Protein Hypothetical protein TTHA0625 [143939] (1 species)

7. Species Thermus thermophilus [TaxId:274] [143940] (2 PDB entries)
   Uniprot Q5SKL8 1-252

8. Domain d2cv9d1: 2cv9 D:1-252 [130858]
   automatically matched to 2CV9 A:1-252

Details for d2cv9d1

PDB Entry: 2cv9, 2.5 Å

PDB Description: Crystal structure of a hypothetical protein from Thermus thermophilus HB8

PDB Compounds: (D:) hypothetical protein TTHA0625

SCOP Domain Sequences for d2cv9d1:

Sequence; same for both SEQRES and ATOM records:

>d2cv9d1 d.159.1.10 (D:1-252) Hypothetical protein TTHA0625 {Thermus thermophilus [TaxId: 274]}
mrvlfigdvmaepglravglhlpdirdrydlviangenaargkgldrrsyrllreagvdl
vslgnhawdhkevyallesepvvrplnyppgtpgkgfwrlevggesllfvqvmgrifmdp
lddpfraldrlleeekadyvlvevhaeatsekmalahyldgrasavlgththvptldatr
lpkgtlyqtdvgmtgtyhsiiggevetflarfltgrpqpfraaqgkarfhatelvfeggr
pvaispyvweep

Timeline for d2cv9d1:

• d2cv9d1 first appeared in SCOP 1.73
  
• d2cv9d1 is called d2cv9d_ in SCOPe 2.01
  
• d2cv9d1 appears in the current release, SCOPe 2.08, called d2cv9d_