Lineage for d2cv9d1 (2cv9 D:1-252)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 736785Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 736786Superfamily d.159.1: Metallo-dependent phosphatases [56300] (10 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 736943Family d.159.1.10: TTHA0625-like [143938] (1 protein)
    part of Pfam PF00149
  6. 736944Protein Hypothetical protein TTHA0625 [143939] (1 species)
  7. 736945Species Thermus thermophilus [TaxId:274] [143940] (1 PDB entry)
  8. 736949Domain d2cv9d1: 2cv9 D:1-252 [130858]
    automatically matched to 2CV9 A:1-252

Details for d2cv9d1

PDB Entry: 2cv9 (more details), 2.5 Å

PDB Description: Crystal structure of a hypothetical protein from Thermus thermophilus HB8
PDB Compounds: (D:) hypothetical protein TTHA0625

SCOP Domain Sequences for d2cv9d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cv9d1 d.159.1.10 (D:1-252) Hypothetical protein TTHA0625 {Thermus thermophilus [TaxId: 274]}
mrvlfigdvmaepglravglhlpdirdrydlviangenaargkgldrrsyrllreagvdl
vslgnhawdhkevyallesepvvrplnyppgtpgkgfwrlevggesllfvqvmgrifmdp
lddpfraldrlleeekadyvlvevhaeatsekmalahyldgrasavlgththvptldatr
lpkgtlyqtdvgmtgtyhsiiggevetflarfltgrpqpfraaqgkarfhatelvfeggr
pvaispyvweep

SCOP Domain Coordinates for d2cv9d1:

Click to download the PDB-style file with coordinates for d2cv9d1.
(The format of our PDB-style files is described here.)

Timeline for d2cv9d1: