Lineage for d2cv9d_ (2cv9 D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998036Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 2998037Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 2998458Family d.159.1.0: automated matches [191347] (1 protein)
    not a true family
  6. 2998459Protein automated matches [190255] (6 species)
    not a true protein
  7. 2998492Species Thermus thermophilus HB8 [TaxId:300852] [187039] (1 PDB entry)
  8. 2998495Domain d2cv9d_: 2cv9 D: [130858]
    Other proteins in same PDB: d2cv9a1
    automated match to d1t70a_

Details for d2cv9d_

PDB Entry: 2cv9 (more details), 2.5 Å

PDB Description: Crystal structure of a hypothetical protein from Thermus thermophilus HB8
PDB Compounds: (D:) hypothetical protein TTHA0625

SCOPe Domain Sequences for d2cv9d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cv9d_ d.159.1.0 (D:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mrvlfigdvmaepglravglhlpdirdrydlviangenaargkgldrrsyrllreagvdl
vslgnhawdhkevyallesepvvrplnyppgtpgkgfwrlevggesllfvqvmgrifmdp
lddpfraldrlleeekadyvlvevhaeatsekmalahyldgrasavlgththvptldatr
lpkgtlyqtdvgmtgtyhsiiggevetflarfltgrpqpfraaqgkarfhatelvfeggr
pvaispyvweep

SCOPe Domain Coordinates for d2cv9d_:

Click to download the PDB-style file with coordinates for d2cv9d_.
(The format of our PDB-style files is described here.)

Timeline for d2cv9d_: