![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
![]() | Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) ![]() different families of this superfamily are groupped in a single Pfam family, Pfam PF00149 |
![]() | Family d.159.1.0: automated matches [191347] (1 protein) not a true family |
![]() | Protein automated matches [190255] (6 species) not a true protein |
![]() | Species Thermus thermophilus HB8 [TaxId:300852] [187039] (1 PDB entry) |
![]() | Domain d2cv9c_: 2cv9 C: [130857] Other proteins in same PDB: d2cv9a1 automated match to d1t70a_ |
PDB Entry: 2cv9 (more details), 2.5 Å
SCOPe Domain Sequences for d2cv9c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cv9c_ d.159.1.0 (C:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} mrvlfigdvmaepglravglhlpdirdrydlviangenaargkgldrrsyrllreagvdl vslgnhawdhkevyallesepvvrplnyppgtpgkgfwrlevggesllfvqvmgrifmdp lddpfraldrlleeekadyvlvevhaeatsekmalahyldgrasavlgththvptldatr lpkgtlyqtdvgmtgtyhsiiggevetflarfltgrpqpfraaqgkarfhatelvfeggr pvaispyvweep
Timeline for d2cv9c_: