SCOPe 2.01: Domain d2cv9b_: 2cv9 B:

Lineage for d2cv9b_ (2cv9 B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.0: automated matches [191347] (1 protein)
   not a true family

6. Protein automated matches [190255] (2 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:300852] [187039] (1 PDB entry)

8. Domain d2cv9b_: 2cv9 B: [130856]
   Other proteins in same PDB: d2cv9a1
   automated match to d1t70a_

Details for d2cv9b_

PDB Entry: 2cv9, 2.5 Å

PDB Description: Crystal structure of a hypothetical protein from Thermus thermophilus HB8

PDB Compounds: (B:) hypothetical protein TTHA0625

SCOPe Domain Sequences for d2cv9b_:

Sequence; same for both SEQRES and ATOM records:

>d2cv9b_ d.159.1.0 (B:) automated matches {Thermus thermophilus [TaxId: 300852]}
mrvlfigdvmaepglravglhlpdirdrydlviangenaargkgldrrsyrllreagvdl
vslgnhawdhkevyallesepvvrplnyppgtpgkgfwrlevggesllfvqvmgrifmdp
lddpfraldrlleeekadyvlvevhaeatsekmalahyldgrasavlgththvptldatr
lpkgtlyqtdvgmtgtyhsiiggevetflarfltgrpqpfraaqgkarfhatelvfeggr
pvaispyvweep

Timeline for d2cv9b_:

• d2cv9b_ first appeared in SCOP 1.73, called d2cv9b1
  
• d2cv9b_ was called d2cv9b1 in SCOP 1.75
  
• d2cv9b_ appears in SCOPe 2.02
  
• d2cv9b_ appears in the current release, SCOPe 2.08