![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
![]() | Superfamily d.159.1: Metallo-dependent phosphatases [56300] (10 families) ![]() different families of this superfamily are groupped in a single Pfam family, Pfam PF00149 |
![]() | Family d.159.1.10: TTHA0625-like [143938] (1 protein) part of Pfam PF00149 |
![]() | Protein Hypothetical protein TTHA0625 [143939] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [143940] (1 PDB entry) |
![]() | Domain d2cv9b1: 2cv9 B:1-252 [130856] automatically matched to 2CV9 A:1-252 |
PDB Entry: 2cv9 (more details), 2.5 Å
SCOP Domain Sequences for d2cv9b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cv9b1 d.159.1.10 (B:1-252) Hypothetical protein TTHA0625 {Thermus thermophilus [TaxId: 274]} mrvlfigdvmaepglravglhlpdirdrydlviangenaargkgldrrsyrllreagvdl vslgnhawdhkevyallesepvvrplnyppgtpgkgfwrlevggesllfvqvmgrifmdp lddpfraldrlleeekadyvlvevhaeatsekmalahyldgrasavlgththvptldatr lpkgtlyqtdvgmtgtyhsiiggevetflarfltgrpqpfraaqgkarfhatelvfeggr pvaispyvweep
Timeline for d2cv9b1: