Lineage for d2cv5h_ (2cv5 H:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1482597Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1482598Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1482599Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1482695Protein Histone H2B [47119] (6 species)
  7. 1482782Species Human (Homo sapiens), H2B.k [TaxId:9606] [140394] (1 PDB entry)
    Uniprot O60814 30-125
  8. 1482784Domain d2cv5h_: 2cv5 H: [130854]
    Other proteins in same PDB: d2cv5a_, d2cv5b_, d2cv5c1, d2cv5e_, d2cv5f_, d2cv5g_
    automated match to d1kx5d_
    protein/DNA complex; complexed with cl, mn

Details for d2cv5h_

PDB Entry: 2cv5 (more details), 2.5 Å

PDB Description: Crystal structure of human nucleosome core particle
PDB Compounds: (H:) Histone H2B K

SCOPe Domain Sequences for d2cv5h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cv5h_ a.22.1.1 (H:) Histone H2B {Human (Homo sapiens), H2B.k [TaxId: 9606]}
rsrkesysvyvykvlkqvhpdtgisskamgimnsfvndiferiageasrlahynkrstit
sreiqtavrlllpgelakhavsegtkavtkytsa

SCOPe Domain Coordinates for d2cv5h_:

Click to download the PDB-style file with coordinates for d2cv5h_.
(The format of our PDB-style files is described here.)

Timeline for d2cv5h_: