![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
![]() | Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
![]() | Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
![]() | Protein Histone H2B [47119] (6 species) |
![]() | Species Human (Homo sapiens), H2B.k [TaxId:9606] [140394] (4 PDB entries) Uniprot O60814 30-125 |
![]() | Domain d2cv5h_: 2cv5 H: [130854] Other proteins in same PDB: d2cv5a_, d2cv5b_, d2cv5c1, d2cv5e_, d2cv5f_, d2cv5g_ automated match to d1kx5d_ protein/DNA complex; complexed with cl, mn |
PDB Entry: 2cv5 (more details), 2.5 Å
SCOPe Domain Sequences for d2cv5h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cv5h_ a.22.1.1 (H:) Histone H2B {Human (Homo sapiens), H2B.k [TaxId: 9606]} rsrkesysvyvykvlkqvhpdtgisskamgimnsfvndiferiageasrlahynkrstit sreiqtavrlllpgelakhavsegtkavtkytsa
Timeline for d2cv5h_: