| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
| Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
| Protein Histone H4 [47125] (7 species) |
| Species Human (Homo sapiens) [TaxId:9606] [192456] (59 PDB entries) |
| Domain d2cv5f_: 2cv5 F: [130852] Other proteins in same PDB: d2cv5a_, d2cv5c1, d2cv5d1, d2cv5e_, d2cv5g_, d2cv5h_ automated match to d1kx5b_ protein/DNA complex; complexed with cl, mn |
PDB Entry: 2cv5 (more details), 2.5 Å
SCOPe Domain Sequences for d2cv5f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cv5f_ a.22.1.1 (F:) Histone H4 {Human (Homo sapiens) [TaxId: 9606]}
hrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehak
rktvtamdvvyalkrqgrtlygfgg
Timeline for d2cv5f_: