Lineage for d2cv5e_ (2cv5 E:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. Protein Histone H3 [47122] (6 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [187038] (23 PDB entries)
  8. Domain d2cv5e_: 2cv5 E: [130851]
    Other proteins in same PDB: d2cv5b_, d2cv5c1, d2cv5d1, d2cv5f_, d2cv5g_, d2cv5h_
    automated match to d1kx5a_
    protein/DNA complex; complexed with cl, mn

Details for d2cv5e_

PDB Entry: 2cv5 (more details), 2.5 Å

PDB Description: Crystal structure of human nucleosome core particle
PDB Compounds: (E:) Histone H3.1

SCOPe Domain Sequences for d2cv5e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cv5e_ a.22.1.1 (E:) Histone H3 {Human (Homo sapiens) [TaxId: 9606]}
kphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeac
eaylvglfedtnlcaihakrvtimpkdiqlarrirgera

SCOPe Domain Coordinates for d2cv5e_ are not available.

Timeline for d2cv5e_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2cv5a_, d2cv5b_, d2cv5c1, d2cv5d1, d2cv5f_, d2cv5g_, d2cv5h_