Lineage for d2cv5a_ (2cv5 A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1482597Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1482598Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1482599Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1482793Protein Histone H3 [47122] (6 species)
  7. 1482891Species Human (Homo sapiens) [TaxId:9606] [187038] (10 PDB entries)
  8. 1482892Domain d2cv5a_: 2cv5 A: [130847]
    Other proteins in same PDB: d2cv5b_, d2cv5c1, d2cv5d1, d2cv5f_, d2cv5g_, d2cv5h_
    automated match to d1kx5a_
    protein/DNA complex; complexed with cl, mn

Details for d2cv5a_

PDB Entry: 2cv5 (more details), 2.5 Å

PDB Description: Crystal structure of human nucleosome core particle
PDB Compounds: (A:) Histone H3.1

SCOPe Domain Sequences for d2cv5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cv5a_ a.22.1.1 (A:) Histone H3 {Human (Homo sapiens) [TaxId: 9606]}
phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeace
aylvglfedtnlcaihakrvtimpkdiqlarrirger

SCOPe Domain Coordinates for d2cv5a_:

Click to download the PDB-style file with coordinates for d2cv5a_.
(The format of our PDB-style files is described here.)

Timeline for d2cv5a_: