![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
![]() | Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
![]() | Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
![]() | Protein Histone H3 [47122] (6 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187038] (10 PDB entries) |
![]() | Domain d2cv5a_: 2cv5 A: [130847] Other proteins in same PDB: d2cv5b_, d2cv5c1, d2cv5d1, d2cv5f_, d2cv5g_, d2cv5h_ automated match to d1kx5a_ protein/DNA complex; complexed with cl, mn |
PDB Entry: 2cv5 (more details), 2.5 Å
SCOPe Domain Sequences for d2cv5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cv5a_ a.22.1.1 (A:) Histone H3 {Human (Homo sapiens) [TaxId: 9606]} phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeace aylvglfedtnlcaihakrvtimpkdiqlarrirger
Timeline for d2cv5a_: