| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
| Protein automated matches [190100] (21 species) not a true protein |
| Species Aeropyrum pernix [TaxId:272557] [186846] (19 PDB entries) |
| Domain d2cv4j_: 2cv4 J: [130846] Other proteins in same PDB: d2cv4a1 automated match to d1vgsd_ complexed with ipa, mes |
PDB Entry: 2cv4 (more details), 2.3 Å
SCOPe Domain Sequences for d2cv4j_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cv4j_ c.47.1.10 (J:) automated matches {Aeropyrum pernix [TaxId: 272557]}
pgsipligerfpemevttdhgviklpdhyvsqgkwfvlfshpadftpvcttefvsfarry
edfqrlgvdliglsvdsvfshikwkewierhigvripfpiiadpqgtvarrlgllhaesa
thtvrgvfivdargvirtmlyypmelgrlvdeilrivkalklgdslkravpadwpnneii
geglivpppttedqararmesgqyrcldwwfcwdtpasrddveearrylrraaekpakll
Timeline for d2cv4j_: