Lineage for d2cv4d1 (2cv4 D:24-173)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 698982Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 698983Superfamily c.47.1: Thioredoxin-like [52833] (22 families) (S)
  5. 699806Family c.47.1.10: Glutathione peroxidase-like [52901] (28 proteins)
  6. 699916Protein Peroxiredoxin [117601] (1 species)
  7. 699917Species Aeropyrum pernix [TaxId:56636] [117602] (2 PDB entries)
  8. 699931Domain d2cv4d1: 2cv4 D:24-173 [130840]
    automatically matched to 2CV4 A:24-173
    complexed with ipa, mes

Details for d2cv4d1

PDB Entry: 2cv4 (more details), 2.3 Å

PDB Description: Crystal Structure of an Archaeal Peroxiredoxin from the Aerobic Hyperthermophilic Crenarchaeon Aeropyrum pernix K1
PDB Compounds: (D:) peroxiredoxin

SCOP Domain Sequences for d2cv4d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cv4d1 c.47.1.10 (D:24-173) Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]}
iklpdhyvsqgkwfvlfshpadftpvcttefvsfarryedfqrlgvdliglsvdsvfshi
kwkewierhigvripfpiiadpqgtvarrlgllhaesathtvrgvfivdargvirtmlyy
pmelgrlvdeilrivkalklgdslkravpa

SCOP Domain Coordinates for d2cv4d1:

Click to download the PDB-style file with coordinates for d2cv4d1.
(The format of our PDB-style files is described here.)

Timeline for d2cv4d1: