Lineage for d2cv4c_ (2cv4 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2877441Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2877880Protein automated matches [190100] (21 species)
    not a true protein
  7. 2877891Species Aeropyrum pernix [TaxId:272557] [186846] (19 PDB entries)
  8. 2877923Domain d2cv4c_: 2cv4 C: [130839]
    Other proteins in same PDB: d2cv4a1
    automated match to d1vgsd_
    complexed with ipa, mes

Details for d2cv4c_

PDB Entry: 2cv4 (more details), 2.3 Å

PDB Description: Crystal Structure of an Archaeal Peroxiredoxin from the Aerobic Hyperthermophilic Crenarchaeon Aeropyrum pernix K1
PDB Compounds: (C:) peroxiredoxin

SCOPe Domain Sequences for d2cv4c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cv4c_ c.47.1.10 (C:) automated matches {Aeropyrum pernix [TaxId: 272557]}
pgsipligerfpemevttdhgviklpdhyvsqgkwfvlfshpadftpvcttefvsfarry
edfqrlgvdliglsvdsvfshikwkewierhigvripfpiiadpqgtvarrlgllhaesa
thtvrgvfivdargvirtmlyypmelgrlvdeilrivkalklgdslkravpadwpnneii
geglivpppttedqararmesgqyrcldwwfcwdtpasrddveearrylrraaekpakll
y

SCOPe Domain Coordinates for d2cv4c_:

Click to download the PDB-style file with coordinates for d2cv4c_.
(The format of our PDB-style files is described here.)

Timeline for d2cv4c_: