SCOP 1.73: Domain d2cv3a1: 2cv3 A:16-255

Lineage for d2cv3a1 (2cv3 A:16-255)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)

6. Protein Elastase [50536] (4 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [50538] (91 PDB entries)

8. Domain d2cv3a1: 2cv3 A:16-255 [130836]
   automatically matched to d1c1ma_
   complexed with frn

Details for d2cv3a1

PDB Entry: 2cv3, 1.9 Å

PDB Description: Crystal structure of porcine pancreatic elastase complexed with a macroclyclic peptide inhibitor

PDB Compounds: (A:) Elastase 1

SCOP Domain Sequences for d2cv3a1:

Sequence; same for both SEQRES and ATOM records:

>d2cv3a1 b.47.1.2 (A:16-255) Elastase {Pig (Sus scrofa) [TaxId: 9823]}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqndgteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

Timeline for d2cv3a1:

• d2cv3a1 is new in SCOP 1.73
  
• d2cv3a1 appears in SCOP 1.75
  
• d2cv3a1 appears in the current release, SCOPe 2.08, called d2cv3a_