Lineage for d2cv2b2 (2cv2 B:1-305)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2118897Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2118898Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2118899Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 2118944Protein Glutamyl-tRNA synthetase (GluRS) [52382] (1 species)
    Catalytic domain is very similar to that of GlnRS
  7. 2118945Species Thermus thermophilus [TaxId:274] [52383] (11 PDB entries)
  8. 2118961Domain d2cv2b2: 2cv2 B:1-305 [130835]
    Other proteins in same PDB: d2cv2a1, d2cv2b1
    automatically matched to d1g59a2
    protein/RNA complex; complexed with cl, gsu, mg

Details for d2cv2b2

PDB Entry: 2cv2 (more details), 2.69 Å

PDB Description: Glutamyl-tRNA synthetase from Thermus thermophilus in complex with tRNA(Glu) and an enzyme inhibitor, Glu-AMS
PDB Compounds: (B:) Glutamyl-tRNA synthetase

SCOPe Domain Sequences for d2cv2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cv2b2 c.26.1.1 (B:1-305) Glutamyl-tRNA synthetase (GluRS) {Thermus thermophilus [TaxId: 274]}
mvvtriapsptgdphvgtayialfnyawarrnggrfivriedtdraryvpgaeerilaal
kwlglsydegpdvggphgpyrqserlplyqkyaeellkrgwayrafetpeeleqirkekg
gydgrarnippeeaeerarrgephvirlkvprpgttevkdelrgvvvydnqeipdvvllk
sdgyptyhlanvvddhlmgvtdviraeewlvstpihvllyrafgweaprfyhmpllrnpd
ktkiskrkshtsldwykaegflpealrnylclmgfsmpdgreiftleefiqaftwervsl
ggpvf

SCOPe Domain Coordinates for d2cv2b2:

Click to download the PDB-style file with coordinates for d2cv2b2.
(The format of our PDB-style files is described here.)

Timeline for d2cv2b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2cv2b1