| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.97: An anticodon-binding domain of class I aminoacyl-tRNA synthetases [48162] (1 superfamily) multihelical; consists of two all-alpha domains |
Superfamily a.97.1: An anticodon-binding domain of class I aminoacyl-tRNA synthetases [48163] (3 families) ![]() |
| Family a.97.1.1: C-terminal domain of glutamyl-tRNA synthetase (GluRS) [48164] (1 protein) |
| Protein C-terminal domain of glutamyl-tRNA synthetase (GluRS) [48165] (1 species) |
| Species Thermus thermophilus [TaxId:274] [48166] (11 PDB entries) |
| Domain d2cv2b1: 2cv2 B:306-468 [130834] Other proteins in same PDB: d2cv2a2, d2cv2b2 automatically matched to d1g59a1 protein/RNA complex; complexed with cl, gsu, mg |
PDB Entry: 2cv2 (more details), 2.69 Å
SCOPe Domain Sequences for d2cv2b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cv2b1 a.97.1.1 (B:306-468) C-terminal domain of glutamyl-tRNA synthetase (GluRS) {Thermus thermophilus [TaxId: 274]}
dleklrwmngkyirevlsleevaervkpflreaglsweseaylrravelmrprfdtlkef
pekarylftedypvsekaqrkleeglpllkelyprlraqeewteaaleallrgfaaekgv
klgqvaqplraaltgsletpglfeilallgkeralrrlerala
Timeline for d2cv2b1: