Lineage for d2cv2a1 (2cv2 A:306-468)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2003435Fold a.97: An anticodon-binding domain of class I aminoacyl-tRNA synthetases [48162] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2003436Superfamily a.97.1: An anticodon-binding domain of class I aminoacyl-tRNA synthetases [48163] (3 families) (S)
  5. 2003437Family a.97.1.1: C-terminal domain of glutamyl-tRNA synthetase (GluRS) [48164] (1 protein)
  6. 2003438Protein C-terminal domain of glutamyl-tRNA synthetase (GluRS) [48165] (1 species)
  7. 2003439Species Thermus thermophilus [TaxId:274] [48166] (11 PDB entries)
  8. 2003454Domain d2cv2a1: 2cv2 A:306-468 [130832]
    Other proteins in same PDB: d2cv2a2, d2cv2b2
    automatically matched to d1g59a1
    protein/RNA complex; complexed with cl, gsu, mg

Details for d2cv2a1

PDB Entry: 2cv2 (more details), 2.69 Å

PDB Description: Glutamyl-tRNA synthetase from Thermus thermophilus in complex with tRNA(Glu) and an enzyme inhibitor, Glu-AMS
PDB Compounds: (A:) Glutamyl-tRNA synthetase

SCOPe Domain Sequences for d2cv2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cv2a1 a.97.1.1 (A:306-468) C-terminal domain of glutamyl-tRNA synthetase (GluRS) {Thermus thermophilus [TaxId: 274]}
dleklrwmngkyirevlsleevaervkpflreaglsweseaylrravelmrprfdtlkef
pekarylftedypvsekaqrkleeglpllkelyprlraqeewteaaleallrgfaaekgv
klgqvaqplraaltgsletpglfeilallgkeralrrlerala

SCOPe Domain Coordinates for d2cv2a1:

Click to download the PDB-style file with coordinates for d2cv2a1.
(The format of our PDB-style files is described here.)

Timeline for d2cv2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2cv2a2