![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) ![]() |
![]() | Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins) contains a conserved all-alpha subdomain at the C-terminal extension |
![]() | Protein Glutamyl-tRNA synthetase (GluRS) [52382] (1 species) Catalytic domain is very similar to that of GlnRS |
![]() | Species Thermus thermophilus [TaxId:274] [52383] (11 PDB entries) |
![]() | Domain d2cv0b2: 2cv0 B:1-305 [130827] Other proteins in same PDB: d2cv0a1, d2cv0b1 automatically matched to d1g59a2 protein/RNA complex; complexed with glu, mg |
PDB Entry: 2cv0 (more details), 2.4 Å
SCOPe Domain Sequences for d2cv0b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cv0b2 c.26.1.1 (B:1-305) Glutamyl-tRNA synthetase (GluRS) {Thermus thermophilus [TaxId: 274]} mvvtriapsptgdphvgtayialfnyawarrnggrfivriedtdraryvpgaeerilaal kwlglsydegpdvggphgpyrqserlplyqkyaeellkrgwayrafetpeeleqirkekg gydgrarnippeeaeerarrgephvirlkvprpgttevkdelrgvvvydnqeipdvvllk sdgyptyhlanvvddhlmgvtdviraeewlvstpihvllyrafgweaprfyhmpllrnpd ktkiskrkshtsldwykaegflpealrnylclmgfsmpdgreiftleefiqaftwervsl ggpvf
Timeline for d2cv0b2: