SCOP 1.73: Domain d2cv0a1: 2cv0 A:306-468

Lineage for d2cv0a1 (2cv0 A:306-468)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.97: An anticodon-binding domain of class I aminoacyl-tRNA synthetases [48162] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.97.1: An anticodon-binding domain of class I aminoacyl-tRNA synthetases [48163] (2 families)

5. Family a.97.1.1: C-terminal domain of glutamyl-tRNA synthetase (GluRS) [48164] (1 protein)

6. Protein C-terminal domain of glutamyl-tRNA synthetase (GluRS) [48165] (1 species)

7. Species Thermus thermophilus [TaxId:274] [48166] (11 PDB entries)

8. Domain d2cv0a1: 2cv0 A:306-468 [130824]
   Other proteins in same PDB: d2cv0a2, d2cv0b2
   automatically matched to d1g59a1
   complexed with glu, mg

Details for d2cv0a1

PDB Entry: 2cv0, 2.4 Å

PDB Description: Glutamyl-tRNA synthetase from Thermus thermophilus in complex with tRNA(Glu) and L-glutamate

PDB Compounds: (A:) Glutamyl-tRNA synthetase

SCOP Domain Sequences for d2cv0a1:

Sequence; same for both SEQRES and ATOM records:

>d2cv0a1 a.97.1.1 (A:306-468) C-terminal domain of glutamyl-tRNA synthetase (GluRS) {Thermus thermophilus [TaxId: 274]}
dleklrwmngkyirevlsleevaervkpflreaglsweseaylrravelmrprfdtlkef
pekarylftedypvsekaqrkleeglpllkelyprlraqeewteaaleallrgfaaekgv
klgqvaqplraaltgsletpglfeilallgkeralrrlerala

Timeline for d2cv0a1:

• d2cv0a1 is new in SCOP 1.73
  
• d2cv0a1 appears in SCOP 1.75
  
• d2cv0a1 appears in the current release, SCOPe 2.08