Lineage for d2cuza2 (2cuz A:1-305)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468308Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2468309Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2468310Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 2468355Protein Glutamyl-tRNA synthetase (GluRS) [52382] (1 species)
    Catalytic domain is very similar to that of GlnRS
  7. 2468356Species Thermus thermophilus [TaxId:274] [52383] (11 PDB entries)
  8. 2468359Domain d2cuza2: 2cuz A:1-305 [130823]
    Other proteins in same PDB: d2cuza1
    automated match to d1j09a2
    protein/RNA complex; complexed with glu

Details for d2cuza2

PDB Entry: 2cuz (more details), 1.98 Å

PDB Description: Glutamyl-tRNA synthetase from Thermus thermophilus in complex with L-glutamate
PDB Compounds: (A:) Glutamyl-tRNA synthetase

SCOPe Domain Sequences for d2cuza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cuza2 c.26.1.1 (A:1-305) Glutamyl-tRNA synthetase (GluRS) {Thermus thermophilus [TaxId: 274]}
mvvtriapsptgdphvgtayialfnyawarrnggrfivriedtdraryvpgaeerilaal
kwlglsydegpdvggphgpyrqserlplyqkyaeellkrgwayrafetpeeleqirkekg
gydgrarnippeeaeerarrgephvirlkvprpgttevkdelrgvvvydnqeipdvvllk
sdgyptyhlanvvddhlmgvtdviraeewlvstpihvllyrafgweaprfyhmpllrnpd
ktkiskrkshtsldwykaegflpealrnylclmgfsmpdgreiftleefiqaftwervsl
ggpvf

SCOPe Domain Coordinates for d2cuza2:

Click to download the PDB-style file with coordinates for d2cuza2.
(The format of our PDB-style files is described here.)

Timeline for d2cuza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2cuza1