SCOPe 2.08: Domain d2cuza2: 2cuz A:1-305

Lineage for d2cuza2 (2cuz A:1-305)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
   contains a conserved all-alpha subdomain at the C-terminal extension

6. Protein Glutamyl-tRNA synthetase (GluRS) [52382] (1 species)
   Catalytic domain is very similar to that of GlnRS

7. Species Thermus thermophilus [TaxId:274] [52383] (11 PDB entries)

8. Domain d2cuza2: 2cuz A:1-305 [130823]
   Other proteins in same PDB: d2cuza1
   automated match to d1j09a2
   protein/RNA complex; complexed with glu

Details for d2cuza2

PDB Entry: 2cuz, 1.98 Å

PDB Description: Glutamyl-tRNA synthetase from Thermus thermophilus in complex with L-glutamate

PDB Compounds: (A:) Glutamyl-tRNA synthetase

SCOPe Domain Sequences for d2cuza2:

Sequence; same for both SEQRES and ATOM records:

>d2cuza2 c.26.1.1 (A:1-305) Glutamyl-tRNA synthetase (GluRS) {Thermus thermophilus [TaxId: 274]}
mvvtriapsptgdphvgtayialfnyawarrnggrfivriedtdraryvpgaeerilaal
kwlglsydegpdvggphgpyrqserlplyqkyaeellkrgwayrafetpeeleqirkekg
gydgrarnippeeaeerarrgephvirlkvprpgttevkdelrgvvvydnqeipdvvllk
sdgyptyhlanvvddhlmgvtdviraeewlvstpihvllyrafgweaprfyhmpllrnpd
ktkiskrkshtsldwykaegflpealrnylclmgfsmpdgreiftleefiqaftwervsl
ggpvf

Timeline for d2cuza2:

• d2cuza2 first appeared in SCOP 1.73
  
• d2cuza2 appears in SCOPe 2.07