SCOPe 2.05: Domain d2cuqa1: 2cuq A:43-74

Lineage for d2cuqa1 (2cuq A:43-74)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.3: LIM domain [57736] (18 proteins)
   duplication: contains two (sub)domains of this fold

6. Protein Four and a half LIM domains 3, FHL3 [144167] (1 species)
   Skeletal muscle lim-protein 2

7. Species Human (Homo sapiens) [TaxId:9606] [144168] (2 PDB entries)
   Uniprot Q13643 127-159! Uniprot Q13643 152-186! Uniprot Q13643 187-218! Uniprot Q13643 98-126

8. Domain d2cuqa1: 2cuq A:43-74 [130818]
   complexed with zn

Details for d2cuqa1

PDB Entry: 2cuq

PDB Description: solution structure of second lim domain from human skeletal muscle lim-protein 2

PDB Compounds: (A:) Four and a half LIM domains 3

SCOPe Domain Sequences for d2cuqa1:

Sequence; same for both SEQRES and ATOM records:

>d2cuqa1 g.39.1.3 (A:43-74) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]}
vctgcqtplagqqftsrdedpycvacfgelfa

Timeline for d2cuqa1:

• d2cuqa1 first appeared in SCOP 1.73
  
• d2cuqa1 appears in SCOPe 2.04
  
• d2cuqa1 appears in SCOPe 2.06
  
• d2cuqa1 appears in the current release, SCOPe 2.08