Lineage for d2cuqa1 (2cuq A:43-74)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 750235Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 750236Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (15 families) (S)
  5. 750327Family g.39.1.3: LIM domain [57736] (18 proteins)
    duplication: contains two (sub)domains of this fold
  6. 750365Protein Four and a half LIM domains 3, FHL3 [144167] (1 species)
    Skeletal muscle lim-protein 2
  7. 750366Species Human (Homo sapiens) [TaxId:9606] [144168] (2 PDB entries)
  8. 750369Domain d2cuqa1: 2cuq A:43-74 [130818]
    complexed with zn

Details for d2cuqa1

PDB Entry: 2cuq (more details)

PDB Description: solution structure of second lim domain from human skeletal muscle lim-protein 2
PDB Compounds: (A:) Four and a half LIM domains 3

SCOP Domain Sequences for d2cuqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cuqa1 g.39.1.3 (A:43-74) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]}
vctgcqtplagqqftsrdedpycvacfgelfa

SCOP Domain Coordinates for d2cuqa1:

Click to download the PDB-style file with coordinates for d2cuqa1.
(The format of our PDB-style files is described here.)

Timeline for d2cuqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2cuqa2