![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
![]() | Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) ![]() |
![]() | Family g.39.1.3: LIM domain [57736] (18 proteins) duplication: contains two (sub)domains of this fold |
![]() | Protein Four and a half LIM domains 3, FHL3 [144167] (1 species) Skeletal muscle lim-protein 2 |
![]() | Species Human (Homo sapiens) [TaxId:9606] [144168] (2 PDB entries) Uniprot Q13643 127-159! Uniprot Q13643 152-186! Uniprot Q13643 187-218! Uniprot Q13643 98-126 |
![]() | Domain d2cuqa1: 2cuq A:43-74 [130818] Other proteins in same PDB: d2cuqa3, d2cuqa4 complexed with zn |
PDB Entry: 2cuq (more details)
SCOPe Domain Sequences for d2cuqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cuqa1 g.39.1.3 (A:43-74) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} vctgcqtplagqqftsrdedpycvacfgelfa
Timeline for d2cuqa1: