Lineage for d2cuqa1 (2cuq A:43-74)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2586757Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 2586758Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 2586896Family g.39.1.3: LIM domain [57736] (18 proteins)
    duplication: contains two (sub)domains of this fold
  6. 2586934Protein Four and a half LIM domains 3, FHL3 [144167] (1 species)
    Skeletal muscle lim-protein 2
  7. 2586935Species Human (Homo sapiens) [TaxId:9606] [144168] (2 PDB entries)
    Uniprot Q13643 127-159! Uniprot Q13643 152-186! Uniprot Q13643 187-218! Uniprot Q13643 98-126
  8. 2586936Domain d2cuqa1: 2cuq A:43-74 [130818]
    Other proteins in same PDB: d2cuqa3, d2cuqa4
    complexed with zn

Details for d2cuqa1

PDB Entry: 2cuq (more details)

PDB Description: Solution Structure of Second Lim Domain from Human Skeletal Muscle Lim-Protein 2
PDB Compounds: (A:) Four and a half LIM domains 3

SCOPe Domain Sequences for d2cuqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cuqa1 g.39.1.3 (A:43-74) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]}
vctgcqtplagqqftsrdedpycvacfgelfa

SCOPe Domain Coordinates for d2cuqa1:

Click to download the PDB-style file with coordinates for d2cuqa1.
(The format of our PDB-style files is described here.)

Timeline for d2cuqa1: