Lineage for d2cupa1 (2cup A:66-95)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035586Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 3035587Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 3035744Family g.39.1.3: LIM domain [57736] (18 proteins)
    duplication: contains two (sub)domains of this fold
  6. 3035788Protein Four and a half LIM domains protein 1, FHL-1 [144163] (1 species)
    Skeletal muscle lim-protein 1
  7. 3035789Species Human (Homo sapiens) [TaxId:9606] [144164] (3 PDB entries)
    Uniprot Q13642 128-159! Uniprot Q13642 161-185! Uniprot Q13642 186-216! Uniprot Q13642 39-66! Uniprot Q13642 67-97! Uniprot Q13642 90-127! Uniprot Q13642 98-127
  8. 3035792Domain d2cupa1: 2cup A:66-95 [130815]
    Other proteins in same PDB: d2cupa4, d2cupa5
    complexed with zn

Details for d2cupa1

PDB Entry: 2cup (more details)

PDB Description: solution structure of the skeletal muscle lim-protein 1
PDB Compounds: (A:) Skeletal muscle LIM-protein 1

SCOPe Domain Sequences for d2cupa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cupa1 g.39.1.3 (A:66-95) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]}
spkckgcfkaivagdqnveykgtvwhkdcf

SCOPe Domain Coordinates for d2cupa1:

Click to download the PDB-style file with coordinates for d2cupa1.
(The format of our PDB-style files is described here.)

Timeline for d2cupa1: