| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
| Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
| Protein Tenascin-X [141045] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [141046] (3 PDB entries) Uniprot P22105 3699-3798! Uniprot P22105 3890-3991! Uniprot P22105 3977-4069 |
| Domain d2cuma1: 2cum A:8-99 [130814] Other proteins in same PDB: d2cuma2, d2cuma3 |
PDB Entry: 2cum (more details)
SCOPe Domain Sequences for d2cuma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cuma1 b.1.2.1 (A:8-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]}
leaprdleakevtprtalltwteppvrpagyllsfhtpggqtqeillpggitshqllglf
pstsynarlqamwgqsllppvstsfttgglri
Timeline for d2cuma1: