Lineage for d2cuma1 (2cum A:8-99)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2761682Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2762131Protein Tenascin-X [141045] (1 species)
  7. 2762132Species Human (Homo sapiens) [TaxId:9606] [141046] (3 PDB entries)
    Uniprot P22105 3699-3798! Uniprot P22105 3890-3991! Uniprot P22105 3977-4069
  8. 2762133Domain d2cuma1: 2cum A:8-99 [130814]
    Other proteins in same PDB: d2cuma2, d2cuma3

Details for d2cuma1

PDB Entry: 2cum (more details)

PDB Description: the solution structure of the 33rd fibronectin type iii domain of human tenascin-x
PDB Compounds: (A:) Tenascin-X

SCOPe Domain Sequences for d2cuma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cuma1 b.1.2.1 (A:8-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]}
leaprdleakevtprtalltwteppvrpagyllsfhtpggqtqeillpggitshqllglf
pstsynarlqamwgqsllppvstsfttgglri

SCOPe Domain Coordinates for d2cuma1:

Click to download the PDB-style file with coordinates for d2cuma1.
(The format of our PDB-style files is described here.)

Timeline for d2cuma1: