Lineage for d2cula1 (2cul A:2-231)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1581823Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 1581824Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 1582678Family c.3.1.7: GidA-like [141946] (1 protein)
    part of Pfam PF01266
  6. 1582679Protein GidA-related protein TTHA1897 [141947] (1 species)
  7. 1582680Species Thermus thermophilus [TaxId:274] [141948] (1 PDB entry)
    Uniprot Q5SH33 2-231
  8. 1582681Domain d2cula1: 2cul A:2-231 [130813]
    complexed with fad

Details for d2cula1

PDB Entry: 2cul (more details), 1.65 Å

PDB Description: Crystal structure of the GidA-related protein from Thermus thermophilus HB8
PDB Compounds: (A:) Glucose-inhibited division protein A-related protein, probable oxidoreductase

SCOPe Domain Sequences for d2cula1:

Sequence, based on SEQRES records: (download)

>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]}
aayqvlivgagfsgaetafwlaqkgvrvglltqsldavmmpflppkppfppgsllerayd
pkdervwafharakylleglrplhlfqatatglllegnrvvgvrtwegppargekvvlav
gsflgarlflggvveeagrlseasypdlledlsrlgfrfveregevpetpstpgyrvryl
afhpeeweektfrlkrleglyavglcvregdyarmseegkrlaehllhel

Sequence, based on observed residues (ATOM records): (download)

>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]}
aayqvlivgagfsgaetafwlaqkgvrvglltqsldavmmpflppkppfppgsllerayd
pkdervwafharakylleglrplhlfqatatglllegnrvvgvrtwegppargekvvlav
gsflgarlflggvveeagrlseasypdlledlsrlgfrfveregevppgyrvrylafhpe
eweektfrlkrleglyavglcvregdyarmseegkrlaehllhel

SCOPe Domain Coordinates for d2cula1:

Click to download the PDB-style file with coordinates for d2cula1.
(The format of our PDB-style files is described here.)

Timeline for d2cula1: