Lineage for d2cuja1 (2cuj A:8-108)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305223Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 2306097Family a.4.1.18: SWIRM domain [140222] (4 proteins)
    Pfam PF04433; contains extra N-terminal helix
  6. 2306131Protein Transcriptional adaptor 2-like, TADA2L [140225] (1 species)
  7. 2306132Species Mouse (Mus musculus) [TaxId:10090] [140226] (3 PDB entries)
    Uniprot Q8CHV6 343-443! Uniprot Q8CHV6 355-443
  8. 2306134Domain d2cuja1: 2cuj A:8-108 [130812]
    Other proteins in same PDB: d2cuja2

Details for d2cuja1

PDB Entry: 2cuj (more details)

PDB Description: solution structure of swirm domain of mouse transcriptional adaptor 2- like
PDB Compounds: (A:) transcriptional adaptor 2-like

SCOPe Domain Sequences for d2cuja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cuja1 a.4.1.18 (A:8-108) Transcriptional adaptor 2-like, TADA2L {Mouse (Mus musculus) [TaxId: 10090]}
idsglspsvlmasnsgrrsapplnltglpgteklnekekelcqvvrlvpgayleyksall
nechkqgglrlaqaralikidvnktrkiydfliregyitka

SCOPe Domain Coordinates for d2cuja1:

Click to download the PDB-style file with coordinates for d2cuja1.
(The format of our PDB-style files is described here.)

Timeline for d2cuja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2cuja2