SCOPe 2.08: Domain d2cuja1: 2cuj A:8-108

Lineage for d2cuja1 (2cuj A:8-108)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.18: SWIRM domain [140222] (4 proteins)
   Pfam PF04433; contains extra N-terminal helix

6. Protein Transcriptional adaptor 2-like, TADA2L [140225] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [140226] (3 PDB entries)
   Uniprot Q8CHV6 343-443! Uniprot Q8CHV6 355-443

8. Domain d2cuja1: 2cuj A:8-108 [130812]
   Other proteins in same PDB: d2cuja2

Details for d2cuja1

PDB Entry: 2cuj

PDB Description: solution structure of swirm domain of mouse transcriptional adaptor 2- like

PDB Compounds: (A:) transcriptional adaptor 2-like

SCOPe Domain Sequences for d2cuja1:

Sequence; same for both SEQRES and ATOM records:

>d2cuja1 a.4.1.18 (A:8-108) Transcriptional adaptor 2-like, TADA2L {Mouse (Mus musculus) [TaxId: 10090]}
idsglspsvlmasnsgrrsapplnltglpgteklnekekelcqvvrlvpgayleyksall
nechkqgglrlaqaralikidvnktrkiydfliregyitka

Timeline for d2cuja1:

• d2cuja1 first appeared in SCOP 1.73
  
• d2cuja1 appears in SCOPe 2.07