Lineage for d2cuia1 (2cui A:6-106)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 657193Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 657194Family b.1.2.1: Fibronectin type III [49266] (43 proteins)
    Pfam PF00041
  6. 657575Protein Tenascin-X [141045] (1 species)
  7. 657576Species Human (Homo sapiens) [TaxId:9606] [141046] (3 PDB entries)
  8. 657579Domain d2cuia1: 2cui A:6-106 [130811]

Details for d2cuia1

PDB Entry: 2cui (more details)

PDB Description: solution structure of the 31st fibronectin type iii domain of the human tenascin x
PDB Compounds: (A:) Tenascin-X

SCOP Domain Sequences for d2cuia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]}
sgsrprlsqlsvtdvttsslrlnweappgafdsfllrfgvpspstlephprpllqrelmv
pgtrhsavlrdlrsgtlysltlyglrgphkadsiqgtartl

SCOP Domain Coordinates for d2cuia1:

Click to download the PDB-style file with coordinates for d2cuia1.
(The format of our PDB-style files is described here.)

Timeline for d2cuia1: