Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
Protein Tenascin-X [141045] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [141046] (3 PDB entries) Uniprot P22105 3699-3798! Uniprot P22105 3890-3991! Uniprot P22105 3977-4069 |
Domain d2cuha1: 2cuh A:8-109 [130810] Other proteins in same PDB: d2cuha2, d2cuha3 |
PDB Entry: 2cuh (more details)
SCOPe Domain Sequences for d2cuha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} pdgptqlralnltegfavlhwkppqnpvdtydiqvtapgapplqaetpgsavdyplhdlv lhtnytatvrglrgpnltspasitfttgleaprdleakevtp
Timeline for d2cuha1: