Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) consists only of helices |
Family a.4.1.1: Homeodomain [46690] (41 proteins) Pfam PF00046 |
Protein Paired box protein pax6 [140143] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [140144] (1 PDB entry) Uniprot P26367 211-278 |
Domain d2cuea1: 2cue A:8-74 [130808] Other proteins in same PDB: d2cuea2, d2cuea3 |
PDB Entry: 2cue (more details)
SCOPe Domain Sequences for d2cuea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cuea1 a.4.1.1 (A:8-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} qrnrtsftqeqiealekeferthypdvfarerlaakidlpeariqvwfsnrrakwrreek lrnqrrq
Timeline for d2cuea1: