Lineage for d2cuea1 (2cue A:7-74)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 634286Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 634287Superfamily a.4.1: Homeodomain-like [46689] (17 families) (S)
    consists only of helices
  5. 634288Family a.4.1.1: Homeodomain [46690] (39 proteins)
    Pfam PF00046
  6. 634426Protein Paired box protein pax6 [140143] (1 species)
  7. 634427Species Human (Homo sapiens) [TaxId:9606] [140144] (1 PDB entry)
  8. 634428Domain d2cuea1: 2cue A:7-74 [130808]

Details for d2cuea1

PDB Entry: 2cue (more details)

PDB Description: solution structure of the homeobox domain of the human paired box protein pax-6
PDB Compounds: (A:) Paired box protein Pax6

SCOP Domain Sequences for d2cuea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]}
gqrnrtsftqeqiealekeferthypdvfarerlaakidlpeariqvwfsnrrakwrree
klrnqrrq

SCOP Domain Coordinates for d2cuea1:

Click to download the PDB-style file with coordinates for d2cuea1.
(The format of our PDB-style files is described here.)

Timeline for d2cuea1: