Lineage for d2cu8a1 (2cu8 A:8-37)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035586Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 3035587Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 3035744Family g.39.1.3: LIM domain [57736] (18 proteins)
    duplication: contains two (sub)domains of this fold
  6. 3035755Protein Cysteine-rich (intestinal) protein, CRP, CRIP [57737] (4 species)
  7. 3035763Species Human (Homo sapiens) [TaxId:9606] [144160] (1 PDB entry)
    Uniprot P52943 1-30! Uniprot P52943 31-63
    CRP2
  8. 3035764Domain d2cu8a1: 2cu8 A:8-37 [130806]
    Other proteins in same PDB: d2cu8a3, d2cu8a4
    complexed with zn

Details for d2cu8a1

PDB Entry: 2cu8 (more details)

PDB Description: solution structure of the lim domain of human cysteine-rich protein 2
PDB Compounds: (A:) Cysteine-rich protein 2

SCOPe Domain Sequences for d2cu8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cu8a1 g.39.1.3 (A:8-37) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]}
maskcpkcdktvyfaekvsslgkdwhkfcl

SCOPe Domain Coordinates for d2cu8a1:

Click to download the PDB-style file with coordinates for d2cu8a1.
(The format of our PDB-style files is described here.)

Timeline for d2cu8a1: