![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (20 families) ![]() consists only of helices |
![]() | Family a.4.1.3: Myb/SANT domain [46739] (16 proteins) |
![]() | Protein MYSM1 (KIAA1915) [140173] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [140174] (1 PDB entry) Uniprot Q5VVJ2 117-181 |
![]() | Domain d2cu7a1: 2cu7 A:8-72 [130805] Other proteins in same PDB: d2cu7a2 |
PDB Entry: 2cu7 (more details)
SCOPe Domain Sequences for d2cu7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} ysvkwtieekelfeqglakfgrrwtkiskligsrtvlqvksyarqyfknkvkcgldketp nqktg
Timeline for d2cu7a1: