SCOPe 2.08: Domain d2cu7a1: 2cu7 A:8-72

Lineage for d2cu7a1 (2cu7 A:8-72)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.3: Myb/SANT domain [46739] (16 proteins)

6. Protein MYSM1 (KIAA1915) [140173] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140174] (1 PDB entry)
   Uniprot Q5VVJ2 117-181

8. Domain d2cu7a1: 2cu7 A:8-72 [130805]
   Other proteins in same PDB: d2cu7a2

Details for d2cu7a1

PDB Entry: 2cu7

PDB Description: solution structure of the sant domain of human kiaa1915 protein

PDB Compounds: (A:) KIAA1915 protein

SCOPe Domain Sequences for d2cu7a1:

Sequence; same for both SEQRES and ATOM records:

>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]}
ysvkwtieekelfeqglakfgrrwtkiskligsrtvlqvksyarqyfknkvkcgldketp
nqktg

Timeline for d2cu7a1:

• d2cu7a1 first appeared in SCOP 1.73
  
• d2cu7a1 appears in SCOPe 2.07