Lineage for d2ctma1 (2ctm A:8-88)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 860093Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
    beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta
  4. 860094Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (1 family) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 860095Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (16 proteins)
    an RNA-binding domain
  6. 860178Protein Vigilin [54797] (1 species)
  7. 860179Species Human (Homo sapiens) [TaxId:9606] [54798] (8 PDB entries)
  8. 860183Domain d2ctma1: 2ctm A:8-88 [130799]

Details for d2ctma1

PDB Entry: 2ctm (more details)

PDB Description: solution structure of the 14th kh type i domain from human vigilin
PDB Compounds: (A:) Vigilin

SCOP Domain Sequences for d2ctma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]}
rivgeleqmvsedvpldhrvhariigargkairkimdefkvdirfpqsgapdpncvtvtg
lpenveeaidhilnleeeyla

SCOP Domain Coordinates for d2ctma1:

Click to download the PDB-style file with coordinates for d2ctma1.
(The format of our PDB-style files is described here.)

Timeline for d2ctma1: