Lineage for d2ctka1 (2ctk A:8-98)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2190768Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
    beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta
  4. 2190769Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (2 families) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 2190770Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (17 proteins)
    an RNA-binding domain
  6. 2190851Protein Vigilin [54797] (1 species)
  7. 2190852Species Human (Homo sapiens) [TaxId:9606] [54798] (8 PDB entries)
  8. 2190854Domain d2ctka1: 2ctk A:8-98 [130797]
    Other proteins in same PDB: d2ctka2, d2ctka3

Details for d2ctka1

PDB Entry: 2ctk (more details)

PDB Description: solution structure of the 12th kh type i domain from human vigilin
PDB Compounds: (A:) Vigilin

SCOPe Domain Sequences for d2ctka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]}
kealealvpvtievevpfdlhryvigqkgsgirkmmdefevnihvpapelqsdiiaitgl
aanldrakagllervkelqaeqedralrsfk

SCOPe Domain Coordinates for d2ctka1:

Click to download the PDB-style file with coordinates for d2ctka1.
(The format of our PDB-style files is described here.)

Timeline for d2ctka1: