Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily) beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta |
Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (1 family) Prokaryotic and eukaryotic domains share a KH-motif but have different topologies |
Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (13 proteins) an RNA-binding domain |
Protein Vigilin [54797] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [54798] (8 PDB entries) |
Domain d2ctfa1: 2ctf A:7-96 [130795] |
PDB Entry: 2ctf (more details)
SCOP Domain Sequences for d2ctfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} gepeklgqaltevyakansftvssvaapswlhrfiigkkgqnlakitqqmpkvhiefteg edkitlegptedvsvaqeqiegmvkdlinr
Timeline for d2ctfa1: