Lineage for d2ctfa1 (2ctf A:8-96)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2514683Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
    beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta
  4. 2514684Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (2 families) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 2514685Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (17 protein domains)
    an RNA-binding domain
  6. 2514766Protein Vigilin [54797] (1 species)
  7. 2514767Species Human (Homo sapiens) [TaxId:9606] [54798] (8 PDB entries)
  8. 2514768Domain d2ctfa1: 2ctf A:8-96 [130795]
    Other proteins in same PDB: d2ctfa2, d2ctfa3

Details for d2ctfa1

PDB Entry: 2ctf (more details)

PDB Description: Solution structure of the 4th KH type I domain from human Vigilin
PDB Compounds: (A:) Vigilin

SCOPe Domain Sequences for d2ctfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ctfa1 d.51.1.1 (A:8-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]}
epeklgqaltevyakansftvssvaapswlhrfiigkkgqnlakitqqmpkvhieftege
dkitlegptedvsvaqeqiegmvkdlinr

SCOPe Domain Coordinates for d2ctfa1:

Click to download the PDB-style file with coordinates for d2ctfa1.
(The format of our PDB-style files is described here.)

Timeline for d2ctfa1: